ToText converts a sequence into plain text format.
ToText is a simple modification of a standard GCG program to convert any sequence into a plain text file.
This program was written by Peter Rice (E-mail: pmr@sanger.ac.uk Post: Informatics Division, The Sanger Centre, Hinxton Hall, Cambridge, CB10 1RQ, UK).
All EGCG programs are supported by the EGCG Support Team, who can be contacted by E-mail (egcg@embnet.org).
Here is a sample session with ToText
% totext
TOTEXT of what GCG sequence(s) ? Sw:laci_ecoli
Start (* 1 *) ?
End (* 360 *) ?
laci_ecoli 360 characters.
%
The output from ToText is a simple report of hits in the sequence.
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPN RVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVE RSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDV SDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAG WHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMA LGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTS VDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPRALADSLMQLA RQVSRLESGQ
The input file for ToText is a GCG sequence file.
All parameters for this program may be put on the command line. Use the option -CHEck to see the summary below and to have a chance to add things to the command line before the program executes. In the summary below, the capitalized letters in the qualifier names are the letters that you must type in order to use the parameter. Square brackets ([ and ]) enclose qualifiers or parameter values that are optional. For more information, see "Using Program Parameters" in Chapter 3, Basic Concepts: Using Programs in the GCG User's Guide.
Minimum syntax: % totext [-INfile=]Sw:laci_ecoli -Default Prompted Parameters: -BEGin=1 -END=576 Range of interest [-OUTfile=]laci_ecoli.txt Output file
Printed: April 22, 1996 15:56 (1162)